| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.1: Ribokinase-like [53613] (6 families) ![]() has extra strand located between strands 2 and 3 |
| Family c.72.1.0: automated matches [191321] (1 protein) not a true family |
| Protein automated matches [190117] (50 species) not a true protein |
| Species Vibrio cholerae [TaxId:345073] [269172] (7 PDB entries) |
| Domain d4xdaa_: 4xda A: [270119] automated match to d1rk2b_ complexed with adp, na, rib |
PDB Entry: 4xda (more details), 1.75 Å
SCOPe Domain Sequences for d4xdaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xdaa_ c.72.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 345073]}
mnklvvlgsvnadhvlqvpsfprpgetlhgrnyqvipggkganqavaaarmqadvgfiac
vgddsfginiresfkldgintagvklqpncptgiamiqvsdsgensicisaeanakltaa
aiepdlaairdaryllmqletpldgilkaaqeaktaktnvilnpaparelpdellkcvdl
itpneteaevltgitvyddssaqqaadalhckgieiviitlgskgvwlsqngrgqripgf
vvkatdttaagdtfngalvtgllqemplesaikfahaaaaisvtrfgaqtsiptraevea
flaehs
Timeline for d4xdaa_: