| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (24 species) not a true protein |
| Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries) |
| Domain d4x7cd1: 4x7c D:1-119 [270118] Other proteins in same PDB: d4x7ca1, d4x7ca2, d4x7cb1, d4x7cb2, d4x7cc2, d4x7cd2 automated match to d4b50a_ |
PDB Entry: 4x7c (more details), 2 Å
SCOPe Domain Sequences for d4x7cd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4x7cd1 b.1.1.1 (D:1-119) automated matches {Vicugna pacos [TaxId: 30538]}
dvqlvesggglvqpggslrlscaasgsifsiyamgwyrqapgkqrelvasissgggtnya
dsvkgrftisgdnakntvylqmnslkpedtavyyckredysayappsgsrgrgtqvtvs
Timeline for d4x7cd1: