SCOPe 2.05: Domain d4x7cc_: 4x7c C:

Lineage for d4x7cc_ (4x7c C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (18 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [189756] (9 PDB entries)

8. Domain d4x7cc_: 4x7c C: [270117]
   automated match to d4b50a_

Details for d4x7cc_

PDB Entry: 4x7c, 2 Å

PDB Description: crystal structure of saga-2006 gii.4 p domain in complex with nano-85

PDB Compounds: (C:) Nano-85 Nanobody

SCOPe Domain Sequences for d4x7cc_:

Sequence, based on SEQRES records:

>d4x7cc_ b.1.1.1 (C:) automated matches {Vicugna pacos [TaxId: 30538]}
dvqlvesggglvqpggslrlscaasgsifsiyamgwyrqapgkqrelvasissgggtnya
dsvkgrftisgdnakntvylqmnslkpedtavyyckredysayappsgsrgrgtqvtvs

Sequence, based on observed residues (ATOM records):

>d4x7cc_ b.1.1.1 (C:) automated matches {Vicugna pacos [TaxId: 30538]}
dvqlvesggglvqpggslrlscaasgsifsiyamgwyrqapgkqrelvasissgggtnya
dsvkgrftisgkntvylqmnslkpedtavyyckredysayappsgsrgrgtqvtvs

Timeline for d4x7cc_:

• d4x7cc_ is new in SCOPe 2.05-stable
  
• d4x7cc_ appears in SCOPe 2.06
  
• d4x7cc_ appears in the current release, SCOPe 2.08, called d4x7cc1