Lineage for d4x7dc_ (4x7d C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2355831Species Llama (Lama glama) [TaxId:9844] [187485] (223 PDB entries)
  8. 2356080Domain d4x7dc_: 4x7d C: [270115]
    Other proteins in same PDB: d4x7dd2
    automated match to d4b50a_
    complexed with edo

Details for d4x7dc_

PDB Entry: 4x7d (more details), 2.15 Å

PDB Description: crystal structure of 2012 nsw gii.4 p domain in complex with nano-85
PDB Compounds: (C:) Nano-85 Nanobody

SCOPe Domain Sequences for d4x7dc_:

Sequence, based on SEQRES records: (download)

>d4x7dc_ b.1.1.1 (C:) automated matches {Llama (Lama glama) [TaxId: 9844]}
dvqlvesggglvqpggslrlscaasgsifsiyamgwyrqapgkqrelvasissgggtnya
dsvkgrftisgdnakntvylqmnslkpedtavyyckredysayappsgsrgrgtqv

Sequence, based on observed residues (ATOM records): (download)

>d4x7dc_ b.1.1.1 (C:) automated matches {Llama (Lama glama) [TaxId: 9844]}
dvqlvesggglvlscaasgsifsiyamgwyrqqrelvasissgggtnyadsvkgrftisg
dnakntvylqmnslkpedtavyyckredysayappsgsrgrgtqv

SCOPe Domain Coordinates for d4x7dc_:

Click to download the PDB-style file with coordinates for d4x7dc_.
(The format of our PDB-style files is described here.)

Timeline for d4x7dc_: