| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.13: Chromo domain-like [54160] (4 families) ![]() SH3-like barrel is capped by a C-terminal helix |
| Family b.34.13.2: Chromo domain [54165] (8 proteins) lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold |
| Protein automated matches [191035] (3 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [255382] (5 PDB entries) |
| Domain d4x3te1: 4x3t E:7-55 [270100] Other proteins in same PDB: d4x3ta2, d4x3tb2, d4x3tc2, d4x3td2, d4x3te2, d4x3tf2 automated match to d2kvma_ complexed with 45e, edo, zn |
PDB Entry: 4x3t (more details), 2.14 Å
SCOPe Domain Sequences for d4x3te1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4x3te1 b.34.13.2 (E:7-55) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
geqvfavesirkkrvrkgkveylvkwkgwppkystwepeehildprlvm
Timeline for d4x3te1: