Lineage for d1ytfc_ (1ytf C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2071735Fold b.56: Transcription factor IIA (TFIIA), beta-barrel domain [50783] (1 superfamily)
    barrel, closed; n=6, S=12; mixed beta-sheet
  4. 2071736Superfamily b.56.1: Transcription factor IIA (TFIIA), beta-barrel domain [50784] (1 family) (S)
    dimer of non-identical beta-sheet domains
  5. 2071737Family b.56.1.1: Transcription factor IIA (TFIIA), beta-barrel domain [50785] (2 proteins)
    heterodimer of two homologous chains
  6. 2071738Protein Large chain TOA1, C-terminal domain [88684] (2 species)
  7. 2071739Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88685] (2 PDB entries)
  8. 2071741Domain d1ytfc_: 1ytf C: [27010]
    Other proteins in same PDB: d1ytfa1, d1ytfa2, d1ytfb_, d1ytfd1, d1ytfd2
    protein/DNA complex

Details for d1ytfc_

PDB Entry: 1ytf (more details), 2.5 Å

PDB Description: yeast tfiia/tbp/dna complex
PDB Compounds: (C:) protein (transcription factor iia - toa1c subunit)

SCOPe Domain Sequences for d1ytfc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ytfc_ b.56.1.1 (C:) Large chain TOA1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
enlmlclydkvtrtkarwkcslkdgvvtinrndytfqkaqveaewv

SCOPe Domain Coordinates for d1ytfc_:

Click to download the PDB-style file with coordinates for d1ytfc_.
(The format of our PDB-style files is described here.)

Timeline for d1ytfc_: