Lineage for d1ytfc1 (1ytf C:)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.56: Transcription factor IIA (TFIIA), N-terminal domain [50783] (1 superfamily) Superfamily b.56.1: Transcription factor IIA (TFIIA), N-terminal domain [50784] (1 family) 
Family b.56.1.1: Transcription factor IIA (TFIIA), N-terminal domain [50785] (1 protein) Protein Transcription factor IIA (TFIIA), N-terminal domain [50786] (1 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50787] (1 PDB entry) 
Domain d1ytfc1: 1ytf C: [27010]
Other proteins in same PDB: d1ytfa1, d1ytfa2, d1ytfb1, d1ytfd1
Details for d1ytfc1
PDB Entry: 1ytf (more details), 2.5 Å
PDB Description: yeast tfiia/tbp/dna complex
SCOP Domain Sequences for d1ytfc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ytfc1 b.56.1.1 (C:) Transcription factor IIA (TFIIA), N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
enlmlclydkvtrtkarwkcslkdgvvtinrndytfqkaqveaewv
SCOP Domain Coordinates for d1ytfc1:
Click to download the PDB-style file with coordinates for d1ytfc1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ytfc1:
- d1ytfc1 first appeared (with stable ids) in SCOP 1.55
- d1ytfc1 appears in SCOP 1.59
- d1ytfc1 appears in the current release, SCOPe 2.08, called d1ytfc_
View in 3D
