Lineage for d4x3ub_ (4x3u B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2785033Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 2785079Family b.34.13.2: Chromo domain [54165] (8 proteins)
    lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold
  6. 2785156Protein automated matches [191035] (3 species)
    not a true protein
  7. 2785183Species Mouse (Mus musculus) [TaxId:10090] [255382] (5 PDB entries)
  8. 2785185Domain d4x3ub_: 4x3u B: [270094]
    automated match to d2kvma_
    complexed with svr

Details for d4x3ub_

PDB Entry: 4x3u (more details), 1.63 Å

PDB Description: crystal structure of chromobox homolog 7 (cbx7) chromodomain with suramin
PDB Compounds: (B:) Chromobox protein homolog 7

SCOPe Domain Sequences for d4x3ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4x3ub_ b.34.13.2 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vfavesirkkrvrkgkveylvkwkgwppkystwepeehildprlvmayeekee

SCOPe Domain Coordinates for d4x3ub_:

Click to download the PDB-style file with coordinates for d4x3ub_.
(The format of our PDB-style files is described here.)

Timeline for d4x3ub_: