SCOPe 2.08: Domain d4x3ub_: 4x3u B:

Lineage for d4x3ub_ (4x3u B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (4 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.2: Chromo domain [54165] (8 proteins)
   lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold

6. Protein automated matches [191035] (3 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [255382] (5 PDB entries)

8. Domain d4x3ub_: 4x3u B: [270094]
   automated match to d2kvma_
   complexed with svr

Details for d4x3ub_

PDB Entry: 4x3u, 1.63 Å

PDB Description: crystal structure of chromobox homolog 7 (cbx7) chromodomain with suramin

PDB Compounds: (B:) Chromobox protein homolog 7

SCOPe Domain Sequences for d4x3ub_:

Sequence; same for both SEQRES and ATOM records:

>d4x3ub_ b.34.13.2 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vfavesirkkrvrkgkveylvkwkgwppkystwepeehildprlvmayeekee

Timeline for d4x3ub_:

• d4x3ub_ first appeared in SCOPe 2.05
  
• d4x3ub_ appears in SCOPe 2.07