![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.80: Tautomerase/MIF [55330] (1 superfamily) (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet generally forms trimers with three closely packed beta-sheets |
![]() | Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) ![]() |
![]() | Family d.80.1.1: 4-oxalocrotonate tautomerase-like [55332] (5 proteins) dimer of beta-alpha-beta subunits: may assemble further in hexamer (trimer of the dimers) |
![]() | Protein 4-oxalocrotonate tautomerase [55333] (2 species) |
![]() | Species Pseudomonas putida, XylH [TaxId:303] [55335] (13 PDB entries) |
![]() | Domain d4x19z_: 4x19 Z: [270088] automated match to d1bjpa_ complexed with nco |
PDB Entry: 4x19 (more details), 1.94 Å
SCOPe Domain Sequences for d4x19z_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4x19z_ d.80.1.1 (Z:) 4-oxalocrotonate tautomerase {Pseudomonas putida, XylH [TaxId: 303]} piaqihilegrsdeqketlirevseaisrsldapltsvrviitemakghfgiggela
Timeline for d4x19z_: