Lineage for d4x19v_ (4x19 V:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2960762Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 2960763Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 2960764Family d.80.1.1: 4-oxalocrotonate tautomerase-like [55332] (5 proteins)
    dimer of beta-alpha-beta subunits: may assemble further in hexamer (trimer of the dimers)
  6. 2960765Protein 4-oxalocrotonate tautomerase [55333] (2 species)
  7. 2960766Species Pseudomonas putida, XylH [TaxId:303] [55335] (13 PDB entries)
  8. 2960836Domain d4x19v_: 4x19 V: [270086]
    automated match to d1bjpa_
    complexed with nco

Details for d4x19v_

PDB Entry: 4x19 (more details), 1.94 Å

PDB Description: crystal structure of native 4-ot from pseudomonas putida mt-2 at 1.94 angstrom
PDB Compounds: (V:) 2-hydroxymuconate tautomerase

SCOPe Domain Sequences for d4x19v_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4x19v_ d.80.1.1 (V:) 4-oxalocrotonate tautomerase {Pseudomonas putida, XylH [TaxId: 303]}
piaqihilegrsdeqketlirevseaisrsldapltsvrviitemakghfgiggelas

SCOPe Domain Coordinates for d4x19v_:

Click to download the PDB-style file with coordinates for d4x19v_.
(The format of our PDB-style files is described here.)

Timeline for d4x19v_: