SCOP 1.67: Domain d1gc6a2: 1gc6 A:199-297

Lineage for d1gc6a2 (1gc6 A:199-297)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.55: PH domain-like [50728] (1 superfamily)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (8 families)

5. Family b.55.1.5: Third domain of FERM [50776] (6 proteins)

6. Protein Radixin [50779] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [50780] (3 PDB entries)

8. Domain d1gc6a2: 1gc6 A:199-297 [27006]
   Other proteins in same PDB: d1gc6a1, d1gc6a3
   complexed with i3p

Details for d1gc6a2

PDB Entry: 1gc6, 2.9 Å

PDB Description: crystal structure of the radixin ferm domain complexed with inositol-(1,4,5)-triphosphate

SCOP Domain Sequences for d1gc6a2:

Sequence; same for both SEQRES and ATOM records:

>d1gc6a2 b.55.1.5 (A:199-297) Radixin {Mouse (Mus musculus)}
emygvnyfeiknkkgtelwlgvdalglniyehddkltpkigfpwseirnisfndkkfvik
pidkkapdfvfyaprlrinkrilalcmgnhelymrrrkp

Timeline for d1gc6a2:

• d1gc6a2 first appeared (with stable ids) in SCOP 1.55
  
• d1gc6a2 appears in SCOP 1.65
  
• d1gc6a2 appears in SCOP 1.69
  
• d1gc6a2 appears in the current release, SCOPe 2.08