SCOPe 2.08: Domain d4x1cf_: 4x1c F:

Lineage for d4x1cf_ (4x1c F:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
   (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
   generally forms trimers with three closely packed beta-sheets

4. Superfamily d.80.1: Tautomerase/MIF [55331] (7 families)

5. Family d.80.1.1: 4-oxalocrotonate tautomerase-like [55332] (5 proteins)
   dimer of beta-alpha-beta subunits: may assemble further in hexamer (trimer of the dimers)

6. Protein 4-oxalocrotonate tautomerase [55333] (2 species)

7. Species Pseudomonas putida, XylH [TaxId:303] [55335] (13 PDB entries)

8. Domain d4x1cf_: 4x1c F: [270053]
   automated match to d1bjpa_
   complexed with nco

Details for d4x1cf_

PDB Entry: 4x1c, 1.7 Å

PDB Description: crystal structure of 4-ot from pseudomonas putida mt-2 with an enamine adduct on the n-terminal proline at 1.7 angstrom resolution

PDB Compounds: (F:) 2-hydroxymuconate tautomerase

SCOPe Domain Sequences for d4x1cf_:

Sequence; same for both SEQRES and ATOM records:

>d4x1cf_ d.80.1.1 (F:) 4-oxalocrotonate tautomerase {Pseudomonas putida, XylH [TaxId: 303]}
xiaqihilegrsdeqketlirevseaisrsldapltsvrviitemakghfgiggela

Timeline for d4x1cf_:

• d4x1cf_ first appeared in SCOPe 2.05
  
• d4x1cf_ appears in SCOPe 2.07