| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.15: SNARE fusion complex [58038] (2 families) ![]() tetrameric parallel coiled coil |
| Family h.1.15.0: automated matches [254266] (1 protein) not a true family |
| Protein automated matches [254614] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [270047] (2 PDB entries) |
| Domain d4wy4b_: 4wy4 B: [270048] automated match to d2npsb_ |
PDB Entry: 4wy4 (more details), 1.4 Å
SCOPe Domain Sequences for d4wy4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wy4b_ h.1.15.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eswetleadlielsqlvtdfsllvnsqqekidsiadhvnsaavnveegtknlgkaaky
Timeline for d4wy4b_: