Lineage for d4wxbd_ (4wxb D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131690Family c.67.1.4: GABA-aminotransferase-like [53417] (17 protein domains)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2131998Protein automated matches [190152] (22 species)
    not a true protein
  7. 2132062Species Streptococcus thermophilus [TaxId:299768] [270038] (3 PDB entries)
  8. 2132068Domain d4wxbd_: 4wxb D: [270045]
    automated match to d1dfoa_
    complexed with cac, cit, gol, na

Details for d4wxbd_

PDB Entry: 4wxb (more details), 2.05 Å

PDB Description: crystal structure of serine hydroxymethyltransferase from streptococcus thermophilus
PDB Compounds: (D:) serine hydroxymethyltransferase

SCOPe Domain Sequences for d4wxbd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wxbd_ c.67.1.4 (D:) automated matches {Streptococcus thermophilus [TaxId: 299768]}
dykafdpelwnaidaeaerqqnnieliasenvvskavmaaqgtlltnkyaegypgkryyg
gtavidvvetlaierakklfgakfanvqphsgsqanaavymsliqpgdtvmgmdlsaggh
lthgapvsfsgktynfvsynvdkeselldydailaqakevrpklivagasaysriidfak
freiadavgaylmvdmahiaglvasghhpspvpyahvttttthktlrgprggliltdded
iakklnsavfpglqggplehviaakavalkealdpafkeygenviknaaamadvfnqhpd
frvisggtnnhlflvdvtkvvengkvaqnvleevnitlnknsipyeqlspfktsgirvgs
paitsrgmgeaesrqiaewmvealenhdkpevlerirgdvkvltdafply

SCOPe Domain Coordinates for d4wxbd_:

Click to download the PDB-style file with coordinates for d4wxbd_.
(The format of our PDB-style files is described here.)

Timeline for d4wxbd_: