![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins) formerly omega-Aminoacid:pyruvate aminotransferase-like |
![]() | Protein automated matches [190152] (25 species) not a true protein |
![]() | Species Streptococcus thermophilus [TaxId:299768] [270038] (8 PDB entries) |
![]() | Domain d4wxfa_: 4wxf A: [270041] automated match to d1dfoa_ complexed with gol, plg |
PDB Entry: 4wxf (more details), 2.4 Å
SCOPe Domain Sequences for d4wxfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wxfa_ c.67.1.4 (A:) automated matches {Streptococcus thermophilus [TaxId: 299768]} dykafdpelwnaidaeaerqqnnieliasenvvskavmaaqgtlltnkyaegypgkryyg gtavidvvetlaierakklfgakfanvqphsgsqanaavymsliqpgdtvmgmdlsaggh lthgapvsfsgktynfvsynvdkeselldydailaqakevrpklivagasaysriidfak freiadavgaylmvdmahiaglvasghhpspvpyahvttttthktlrgprggliltdded iakklnsavfpglqggplehviaakavalkealdpafkeygenviknaaamadvfnqhpd frvisggtnnhlflvdvtkvvengkvaqnvleevnitlnknsipyeqlspfktsgirvgs paitsrgmgeaesrqiaewmvealenhdkpevlerirgdvkvltdafply
Timeline for d4wxfa_: