Lineage for d1ef1b2 (1ef1 B:199-297)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 232087Fold b.55: PH domain-like [50728] (1 superfamily)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 232088Superfamily b.55.1: PH domain-like [50729] (6 families) (S)
  5. 232223Family b.55.1.5: Third domain of FERM [50776] (6 proteins)
  6. 232239Protein Moesin [50777] (1 species)
  7. 232240Species Human (Homo sapiens) [TaxId:9606] [50778] (2 PDB entries)
  8. 232242Domain d1ef1b2: 1ef1 B:199-297 [27004]
    Other proteins in same PDB: d1ef1a1, d1ef1a3, d1ef1b1, d1ef1b3, d1ef1c_, d1ef1d_
    complexed with so4

Details for d1ef1b2

PDB Entry: 1ef1 (more details), 1.9 Å

PDB Description: crystal structure of the moesin ferm domain/tail domain complex

SCOP Domain Sequences for d1ef1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ef1b2 b.55.1.5 (B:199-297) Moesin {Human (Homo sapiens)}
emygvnyfsiknkkgselwlgvdalglniyeqndrltpkigfpwseirnisfndkkfvik
pidkkapdfvfyaprlrinkrilalcmgnhelymrrrkp

SCOP Domain Coordinates for d1ef1b2:

Click to download the PDB-style file with coordinates for d1ef1b2.
(The format of our PDB-style files is described here.)

Timeline for d1ef1b2: