Lineage for d4wxga_ (4wxg A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896011Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2896366Protein automated matches [190152] (25 species)
    not a true protein
  7. 2896466Species Streptococcus thermophilus [TaxId:299768] [270038] (8 PDB entries)
  8. 2896472Domain d4wxga_: 4wxg A: [270039]
    automated match to d1dfoa_
    complexed with 2bo, gol, na

Details for d4wxga_

PDB Entry: 4wxg (more details), 2 Å

PDB Description: crystal structure of l-serine hydroxymethyltransferase in complex with a mixture of l-threonine and glycine
PDB Compounds: (A:) serine hydroxymethyltransferase

SCOPe Domain Sequences for d4wxga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wxga_ c.67.1.4 (A:) automated matches {Streptococcus thermophilus [TaxId: 299768]}
dykafdpelwnaidaeaerqqnnieliasenvvskavmaaqgtlltnkyaegypgkryyg
gtavidvvetlaierakklfgakfanvqphsgsqanaavymsliqpgdtvmgmdlsaggh
lthgapvsfsgktynfvsynvdkeselldydailaqakevrpklivagasaysriidfak
freiadavgaylmvdmahiaglvasghhpspvpyahvttttthktlrgprggliltdded
iakklnsavfpglqggplehviaakavalkealdpafkeygenviknaaamadvfnqhpd
frvisggtnnhlflvdvtkvvengkvaqnvleevnitlnknsipyeqlspfktsgirvgs
paitsrgmgeaesrqiaewmvealenhdkpevlerirgdvkvltdafply

SCOPe Domain Coordinates for d4wxga_:

Click to download the PDB-style file with coordinates for d4wxga_.
(The format of our PDB-style files is described here.)

Timeline for d4wxga_: