Lineage for d1ef1a2 (1ef1 A:199-297)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2394380Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2394381Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2394816Family b.55.1.5: Third domain of FERM [50776] (8 protein domains)
  6. 2394838Protein Moesin [50777] (2 species)
  7. 2394839Species Human (Homo sapiens) [TaxId:9606] [50778] (3 PDB entries)
    Uniprot P26038 4-297
  8. 2394840Domain d1ef1a2: 1ef1 A:199-297 [27003]
    Other proteins in same PDB: d1ef1a1, d1ef1a3, d1ef1b1, d1ef1b3, d1ef1c_, d1ef1d_
    complexed with so4

Details for d1ef1a2

PDB Entry: 1ef1 (more details), 1.9 Å

PDB Description: crystal structure of the moesin ferm domain/tail domain complex
PDB Compounds: (A:) moesin

SCOPe Domain Sequences for d1ef1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ef1a2 b.55.1.5 (A:199-297) Moesin {Human (Homo sapiens) [TaxId: 9606]}
emygvnyfsiknkkgselwlgvdalglniyeqndrltpkigfpwseirnisfndkkfvik
pidkkapdfvfyaprlrinkrilalcmgnhelymrrrkp

SCOPe Domain Coordinates for d1ef1a2:

Click to download the PDB-style file with coordinates for d1ef1a2.
(The format of our PDB-style files is described here.)

Timeline for d1ef1a2: