SCOPe 2.04: Domain d1ddva_: 1ddv A:

Lineage for d1ddva_ (1ddv A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (7 proteins)

6. Protein Homer [50774] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [50775] (3 PDB entries)

8. Domain d1ddva_: 1ddv A: [27002]

Details for d1ddva_

PDB Entry: 1ddv, 1.9 Å

PDB Description: crystal structure of the homer evh1 domain with bound mglur peptide

PDB Compounds: (A:) glgf-domain protein homer

SCOPe Domain Sequences for d1ddva_:

Sequence; same for both SEQRES and ATOM records:

>d1ddva_ b.55.1.4 (A:) Homer {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ifstrahvfqidpntkknwvptskhavtvsyfydstrnvyriisldgskaiinstitpnm
tftktsqkfgqwadsrantvyglgfssehhlskfaekfqefkea

Timeline for d1ddva_:

• d1ddva_ first appeared (with stable ids) in SCOP 1.55
  
• d1ddva_ appears in SCOPe 2.03
  
• d1ddva_ appears in SCOPe 2.05
  
• d1ddva_ appears in the current release, SCOPe 2.08