Lineage for d1ddva_ (1ddv A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1132154Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1132155Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1132514Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (6 proteins)
  6. 1132531Protein Homer [50774] (2 species)
  7. 1132537Species Norway rat (Rattus norvegicus) [TaxId:10116] [50775] (3 PDB entries)
  8. 1132540Domain d1ddva_: 1ddv A: [27002]

Details for d1ddva_

PDB Entry: 1ddv (more details), 1.9 Å

PDB Description: crystal structure of the homer evh1 domain with bound mglur peptide
PDB Compounds: (A:) glgf-domain protein homer

SCOPe Domain Sequences for d1ddva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ddva_ b.55.1.4 (A:) Homer {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ifstrahvfqidpntkknwvptskhavtvsyfydstrnvyriisldgskaiinstitpnm
tftktsqkfgqwadsrantvyglgfssehhlskfaekfqefkea

SCOPe Domain Coordinates for d1ddva_:

Click to download the PDB-style file with coordinates for d1ddva_.
(The format of our PDB-style files is described here.)

Timeline for d1ddva_: