Lineage for d1ddva_ (1ddv A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 113158Fold b.55: PH domain-like [50728] (1 superfamily)
  4. 113159Superfamily b.55.1: PH domain-like [50729] (5 families) (S)
  5. 113253Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (4 proteins)
  6. 113261Protein Homer [50774] (2 species)
  7. 113267Species Rat (Rattus norvegicus) [TaxId:10116] [50775] (2 PDB entries)
  8. 113269Domain d1ddva_: 1ddv A: [27002]

Details for d1ddva_

PDB Entry: 1ddv (more details), 1.9 Å

PDB Description: crystal structure of the homer evh1 domain with bound mglur peptide

SCOP Domain Sequences for d1ddva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ddva_ b.55.1.4 (A:) Homer {Rat (Rattus norvegicus)}
ifstrahvfqidpntkknwvptskhavtvsyfydstrnvyriisldgskaiinstitpnm
tftktsqkfgqwadsrantvyglgfssehhlskfaekfqefkea

SCOP Domain Coordinates for d1ddva_:

Click to download the PDB-style file with coordinates for d1ddva_.
(The format of our PDB-style files is described here.)

Timeline for d1ddva_: