Lineage for d1ddva_ (1ddv A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (7 proteins)
  6. Protein Homer [50774] (2 species)
  7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [50775] (3 PDB entries)
  8. Domain d1ddva_: 1ddv A: [27002]

Details for d1ddva_

PDB Entry: 1ddv (more details), 1.9 Å

PDB Description: crystal structure of the homer evh1 domain with bound mglur peptide
PDB Compounds: (A:) glgf-domain protein homer

SCOPe Domain Sequences for d1ddva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ddva_ b.55.1.4 (A:) Homer {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ifstrahvfqidpntkknwvptskhavtvsyfydstrnvyriisldgskaiinstitpnm
tftktsqkfgqwadsrantvyglgfssehhlskfaekfqefkea

SCOPe Domain Coordinates for d1ddva_ are not available.

Timeline for d1ddva_: