![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.80: Tautomerase/MIF [55330] (1 superfamily) (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet generally forms trimers with three closely packed beta-sheets |
![]() | Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) ![]() |
![]() | Family d.80.1.3: MIF-related [55339] (3 proteins) automatically mapped to Pfam PF01187 |
![]() | Protein Microphage migration inhibition factor (MIF) [55340] (7 species) synonym: glycosylation-inhibiting factor (GIF) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55341] (94 PDB entries) |
![]() | Domain d4wr8e_: 4wr8 E: [269995] automated match to d1ljta_ complexed with 3tx, na, so4 |
PDB Entry: 4wr8 (more details), 2.6 Å
SCOPe Domain Sequences for d4wr8e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wr8e_ d.80.1.3 (E:) Microphage migration inhibition factor (MIF) {Human (Homo sapiens) [TaxId: 9606]} pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
Timeline for d4wr8e_: