Lineage for d4wp7a_ (4wp7 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2140673Family c.82.1.1: ALDH-like [53721] (6 protein domains)
  6. 2140987Protein automated matches [190401] (5 species)
    not a true protein
  7. 2140988Species Human (Homo sapiens) [TaxId:9606] [189906] (18 PDB entries)
  8. 2140994Domain d4wp7a_: 4wp7 A: [269990]
    automated match to d1o9ja_
    complexed with 3sr, cl, yb

Details for d4wp7a_

PDB Entry: 4wp7 (more details), 1.8 Å

PDB Description: structure of human aldh1a1 with inhibitor cm026
PDB Compounds: (A:) Retinal dehydrogenase 1

SCOPe Domain Sequences for d4wp7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wp7a_ c.82.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlpvlltdlkiqytkifinnewhdsvsgkkfpvfnpateeelcqveegdkedvdkavkaa
rqafqigspwrtmdasergrllykladlierdrlllatmesmnggklysnaylsdlagci
ktlrycagwadkiqgrtipidgnfftytrhepigvcgqiipwnfplvmliwkigpalscg
ntvvvkpaeqtpltalhvaslikeagfppgvvnivpgygptagaaisshmdidkvaftgs
tevgklikeaagksnlkrvtlelggkspcivladadldnavefahhgvfyhqgqcciaas
rifveesiydefvrrsverakkyilgnpltpgvtqgpqidkeqydkildliesgkkegak
lecgggpwgnkgyfvqptvfsnvtdemriakeeifgpvqqimkfkslddvikranntfyg
lsagvftkdidkaitissalqagtvwvncygvvsaqcpfggfkmsgngrelgeygfheyt
evktvtvkisqkns

SCOPe Domain Coordinates for d4wp7a_:

Click to download the PDB-style file with coordinates for d4wp7a_.
(The format of our PDB-style files is described here.)

Timeline for d4wp7a_: