Lineage for d4woha1 (4woh A:1-155)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2875105Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2875106Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2875762Family c.45.1.0: automated matches [191381] (1 protein)
    not a true family
  6. 2875763Protein automated matches [190475] (10 species)
    not a true protein
  7. 2875775Species Human (Homo sapiens) [TaxId:9606] [187400] (140 PDB entries)
  8. 2875791Domain d4woha1: 4woh A:1-155 [269989]
    Other proteins in same PDB: d4woha2
    automated match to d1yz4a_
    complexed with 4np, edo, peg

Details for d4woha1

PDB Entry: 4woh (more details), 1.34 Å

PDB Description: structure of of human dual-specificity phosphatase 22 (e24a/k28a/k30a/c88s) complexed with 4-nitrophenolphosphate
PDB Compounds: (A:) Dual specificity protein phosphatase 22

SCOPe Domain Sequences for d4woha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4woha1 c.45.1.0 (A:1-155) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgngmnkilpglyignfkdardaaqlsanavthilsvhdsarpmlegvkylcipaadsps
qnltrhfkesikfihecrlrgesclvhslagvsrsvtlviayimtvtdfgwedalhtvra
grscanpnvgfqrqlqefekhevhqyrqwlkeeyg

SCOPe Domain Coordinates for d4woha1:

Click to download the PDB-style file with coordinates for d4woha1.
(The format of our PDB-style files is described here.)

Timeline for d4woha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4woha2