![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
![]() | Protein automated matches [227017] (58 species) not a true protein |
![]() | Species Influenza A virus [TaxId:489926] [269970] (1 PDB entry) |
![]() | Domain d4w8ne_: 4w8n E: [269974] Other proteins in same PDB: d4w8na2, d4w8nb_, d4w8nc2, d4w8nd_, d4w8nf_ automated match to d4fiua1 complexed with nag |
PDB Entry: 4w8n (more details), 2.9 Å
SCOPe Domain Sequences for d4w8ne_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4w8ne_ b.19.1.0 (E:) automated matches {Influenza A virus [TaxId: 489926]} qicigyhannstekvdtilernvtvthaknilekthngklcrlsgipplelgdcsiagwl lgnpecdrllsvpewsyivekenpvnglcypgsfndyeelkhlltsvthfekvkilprdq wtqhtttggsracavsgnpsffrnmvwltkkgsnypiakrsynntsgeqmlviwgihhpn ddaeqrtlyqnvgtyvsvgtstlnkrsipeiatrpkvnglggrmefswtlletwdvinfe stgnliapeygfkiskrgssgimktekilencetkcqtplgainttlpfhnihpltigec pkyvksdrlilatglrnvp
Timeline for d4w8ne_: