SCOPe 2.05: Domain d4w8nb_: 4w8n B:

Lineage for d4w8nb_ (4w8n B:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein Influenza hemagglutinin (stalk) [58066] (8 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (109 PDB entries)

8. Domain d4w8nb_: 4w8n B: [269973]
   Other proteins in same PDB: d4w8na_, d4w8nc_, d4w8ne_
   automated match to d3gbmb_
   complexed with nag, ndg

Details for d4w8nb_

PDB Entry: 4w8n, 2.9 Å

PDB Description: the crystal structure of hemagglutinin from a swine influenza virus (a/swine/missouri/2124514/2006)

PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4w8nb_:

Sequence; same for both SEQRES and ATOM records:

>d4w8nb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
gaiagfieggwqgmvdgwygyhhsndqgsgyaadkestqkaidgitnkvnsviekmntqf
eavgkefnnlerrlenlnkkmedgfidvwtynaellvlmenertldfhdsnvknlydkvr
mqlrdnakeigngcfefyhkcddecmnsvrngtydyikyeeesklnrne

Timeline for d4w8nb_:

• d4w8nb_ is new in SCOPe 2.05-stable
  
• d4w8nb_ appears in SCOPe 2.06
  
• d4w8nb_ appears in the current release, SCOPe 2.08