SCOPe 2.08: Domain d4w8nc1: 4w8n C:1-325

Lineage for d4w8nc1 (4w8n C:1-325)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (58 species)
   not a true protein

7. Species Influenza A virus [TaxId:489926] [269970] (1 PDB entry)

8. Domain d4w8nc1: 4w8n C:1-325 [269971]
   Other proteins in same PDB: d4w8na2, d4w8nb_, d4w8nc2, d4w8nd_, d4w8nf_
   automated match to d4fiua1
   complexed with nag

Details for d4w8nc1

PDB Entry: 4w8n, 2.9 Å

PDB Description: the crystal structure of hemagglutinin from a swine influenza virus (a/swine/missouri/2124514/2006)

PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d4w8nc1:

Sequence; same for both SEQRES and ATOM records:

>d4w8nc1 b.19.1.0 (C:1-325) automated matches {Influenza A virus [TaxId: 489926]}
dqicigyhannstekvdtilernvtvthaknilekthngklcrlsgipplelgdcsiagw
llgnpecdrllsvpewsyivekenpvnglcypgsfndyeelkhlltsvthfekvkilprd
qwtqhtttggsracavsgnpsffrnmvwltkkgsnypiakrsynntsgeqmlviwgihhp
nddaeqrtlyqnvgtyvsvgtstlnkrsipeiatrpkvnglggrmefswtlletwdvinf
estgnliapeygfkiskrgssgimktekilencetkcqtplgainttlpfhnihpltige
cpkyvksdrlilatglrnvpqiesr

Timeline for d4w8nc1:

• d4w8nc1 first appeared in SCOPe 2.05, called d4w8nc_
  
• d4w8nc1 appears in SCOPe 2.07