Class b: All beta proteins [48724] (174 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (13 families) |
Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (6 proteins) |
Protein Enabled [50768] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [50769] (1 PDB entry) |
Domain d1evha_: 1evh A: [26997] complexed with ace |
PDB Entry: 1evh (more details), 1.8 Å
SCOP Domain Sequences for d1evha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1evha_ b.55.1.4 (A:) Enabled {Mouse (Mus musculus) [TaxId: 10090]} seqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvvin caipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevln
Timeline for d1evha_: