SCOPe 2.07: Domain d4w7la_: 4w7l A:

Lineage for d4w7la_ (4w7l A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.0: automated matches [191316] (1 protein)
   not a true family

6. Protein automated matches [190081] (31 species)
   not a true protein

7. Species Auricularia auricula-judae [TaxId:29892] [193309] (12 PDB entries)

8. Domain d4w7la_: 4w7l A: [269957]
   automated match to d4au9a_
   complexed with hem; mutant

Details for d4w7la_

PDB Entry: 4w7l, 1.05 Å

PDB Description: crystal structure of a decolorizing peroxidase (dyp) from auricularia auricula-judae. d168n mutant

PDB Compounds: (A:) dye-decolorizing peroxidase

SCOPe Domain Sequences for d4w7la_:

Sequence; same for both SEQRES and ATOM records:

>d4w7la_ d.58.4.0 (A:) automated matches {Auricularia auricula-judae [TaxId: 29892]}
atslntidiqgdilvgmhkqkqlfyffaindpatfkthlasdiapvvasvtqlsnvatqp
lvalniafsntgllalgvtdnlgdslfangqakdatsfkestsswvpqfagtgihgviil
asdttdlidqqvasiestfgssisklyslsasirpgneaghemfgflngiaqpaingfnt
plpgqnivdagviitgatndpitrpswavggsflafrqleqlvpefnkylldnapagsgs
lqaradllgarmvgrwksgapidltptaddpalgadaqrnnnftyshagfdlgsdqshcp
fsahirktrpradlggsltppnlsagansimrsgipygpevtsaesasntttqerglafv
ayqaqlsqgfhflqqtwadnanfppgktpatvgldpiigqnngqprvvngllpsnssasl
sipqfvvshggeyffsppisaiggrlsa

Timeline for d4w7la_:

• d4w7la_ first appeared in SCOPe 2.05
  
• d4w7la_ appears in SCOPe 2.06
  
• d4w7la_ appears in the current release, SCOPe 2.08