SCOPe 2.07: Domain d4w7nb_: 4w7n B:

Lineage for d4w7nb_ (4w7n B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.0: automated matches [191316] (1 protein)
   not a true family

6. Protein automated matches [190081] (31 species)
   not a true protein

7. Species Auricularia auricula-judae [TaxId:29892] [193309] (12 PDB entries)

8. Domain d4w7nb_: 4w7n B: [269954]
   automated match to d4au9a_
   complexed with hem; mutant

Details for d4w7nb_

PDB Entry: 4w7n, 1.4 Å

PDB Description: crystal structure of a decolorizing peroxidase (dyp) from auricularia auricula-judae. y147s and w377s double mutant

PDB Compounds: (B:) dye-decolorizing peroxidase

SCOPe Domain Sequences for d4w7nb_:

Sequence; same for both SEQRES and ATOM records:

>d4w7nb_ d.58.4.0 (B:) automated matches {Auricularia auricula-judae [TaxId: 29892]}
slntidiqgdilvgmhkqkqlfyffaindpatfkthlasdiapvvasvtqlsnvatqplv
alniafsntgllalgvtdnlgdslfangqakdatsfkestsswvpqfagtgihgviilas
dttdlidqqvasiestfgssisklsslsasirpgneaghemfgfldgiaqpaingfntpl
pgqnivdagviitgatndpitrpswavggsflafrqleqlvpefnkylldnapagsgslq
aradllgarmvgrwksgapidltptaddpalgadaqrnnnftyshagfdlgsdqshcpfs
ahirktrpradlggsltppnlsagansimrsgipygpevtsaesasntttqerglafvay
qaqlsqgfhflqqtsadnanfppgktpatvgldpiigqnngqprvvngllpsnssaslsi
pqfvvshggeyffsppisaiggrlsa

Timeline for d4w7nb_:

• d4w7nb_ first appeared in SCOPe 2.05
  
• d4w7nb_ appears in SCOPe 2.06
  
• d4w7nb_ appears in the current release, SCOPe 2.08