Lineage for d4w7nb_ (4w7n B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1906842Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 1907207Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 1907208Protein automated matches [190081] (21 species)
    not a true protein
  7. 1907217Species Auricularia auricula-judae [TaxId:29892] [193309] (8 PDB entries)
  8. 1907226Domain d4w7nb_: 4w7n B: [269954]
    automated match to d4au9a_
    complexed with hem; mutant

Details for d4w7nb_

PDB Entry: 4w7n (more details), 1.4 Å

PDB Description: crystal structure of a decolorizing peroxidase (dyp) from auricularia auricula-judae. y147s and w377s double mutant
PDB Compounds: (B:) dye-decolorizing peroxidase

SCOPe Domain Sequences for d4w7nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4w7nb_ d.58.4.0 (B:) automated matches {Auricularia auricula-judae [TaxId: 29892]}
slntidiqgdilvgmhkqkqlfyffaindpatfkthlasdiapvvasvtqlsnvatqplv
alniafsntgllalgvtdnlgdslfangqakdatsfkestsswvpqfagtgihgviilas
dttdlidqqvasiestfgssisklsslsasirpgneaghemfgfldgiaqpaingfntpl
pgqnivdagviitgatndpitrpswavggsflafrqleqlvpefnkylldnapagsgslq
aradllgarmvgrwksgapidltptaddpalgadaqrnnnftyshagfdlgsdqshcpfs
ahirktrpradlggsltppnlsagansimrsgipygpevtsaesasntttqerglafvay
qaqlsqgfhflqqtsadnanfppgktpatvgldpiigqnngqprvvngllpsnssaslsi
pqfvvshggeyffsppisaiggrlsa

SCOPe Domain Coordinates for d4w7nb_:

Click to download the PDB-style file with coordinates for d4w7nb_.
(The format of our PDB-style files is described here.)

Timeline for d4w7nb_: