Lineage for d4w7jc_ (4w7j C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2950158Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 2950159Protein automated matches [190081] (33 species)
    not a true protein
  7. 2950173Species Auricularia auricula-judae [TaxId:29892] [193309] (12 PDB entries)
  8. 2950190Domain d4w7jc_: 4w7j C: [269947]
    automated match to d4au9a_
    complexed with hem

Details for d4w7jc_

PDB Entry: 4w7j (more details), 1.79 Å

PDB Description: crystal structure of a decolorizing peroxidase (dyp) from auricularia auricula-judae
PDB Compounds: (C:) dye-decolorizing peroxidase

SCOPe Domain Sequences for d4w7jc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4w7jc_ d.58.4.0 (C:) automated matches {Auricularia auricula-judae [TaxId: 29892]}
lntidiqgdilvgmhkqkqlfyffaindpatfkthlasdiapvvasvtqlsnvatqplva
lniafsntgllalgvtdnlgdslfangqakdatsfkestsswvpqfagtgihgviilasd
ttdlidqqvasiestfgssisklyslsasirpgneaghemfgfldgiaqpaingfntplp
gqnivdagviitgatndpitrpswavggsflafrqleqlvpefnkylldnapagsgslqa
radllgarmvgrwksgapidltptaddpalgadaqrnnnftyshagfdlgsdqshcpfsa
hirktrpradlggsltppnlsagansimrsgipygpevtsaesasntttqerglafvayq
aqlsqgfhflqqtwadnanfppgktpatvgldpiigqnngqprvvngllpsnssaslsip
qfvvshggeyffsppisaiggrlsa

SCOPe Domain Coordinates for d4w7jc_:

Click to download the PDB-style file with coordinates for d4w7jc_.
(The format of our PDB-style files is described here.)

Timeline for d4w7jc_: