![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.1: Papain-like [54002] (26 proteins) |
![]() | Protein Cruzain [54020] (1 species) |
![]() | Species Trypanosoma cruzi [TaxId:5693] [54021] (29 PDB entries) |
![]() | Domain d4w5bc_: 4w5b C: [269946] automated match to d3i06a_ complexed with 3h5 |
PDB Entry: 4w5b (more details), 2.7 Å
SCOPe Domain Sequences for d4w5bc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4w5bc_ d.3.1.1 (C:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} apaavdwrargavtavkdqgqcgsswafsaignvecqwflaghpltnlseqmlvscdktd sgcsgglmnnafewivqenngavytedsypyasgegisppcttsghtvgatitghvelpq deaqiaawlavngpvavavdasswmtytggvmtscvseqldhgvllvgyndsaavpywii knswttqwgeegyiriakgsnqclvkeeassavvg
Timeline for d4w5bc_: