SCOPe 2.06: Domain d3vgja_: 3vgj A:

Lineage for d3vgja_ (3vgj A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (50 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [269943] (7 PDB entries)

8. Domain d3vgja_: 3vgj A: [269945]
   automated match to d2cyaa_
   protein/RNA complex; complexed with amp, tyr

Details for d3vgja_

PDB Entry: 3vgj, 2.21 Å

PDB Description: crystal of plasmodium falciparum tyrosyl-trna synthetase (pftyrrs)in complex with adenylate analog

PDB Compounds: (A:) Tyrosyl-tRNA synthetase, putative

SCOPe Domain Sequences for d3vgja_:

Sequence; same for both SEQRES and ATOM records:

>d3vgja_ c.26.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
eeskiedvdkilndilsisseciqpdelrvklllkrklicydgfepsgrmhiaqgllksi
ivnkltsngctfifwiadwfahlnnkmsgdlkkikkvgsyfievwkscgmnmenvqflwa
seeinkkpneywslvldisrsfninrmkrclkimgrsegeenycsqilypcmqcadiffl
nvdicqlgidqrkvnmlareycdikkikkkpvilshgmlpgllegqekmsksdensaifm
ddsesdvnrkikkaycppnviennpiyayaksiifpsynefnlvrkeknggdktyytlqe
lehdyvngfihpldlkdnvamyinkllqpvrdhfqnnieaknllneikkykvt

Timeline for d3vgja_:

• d3vgja_ first appeared in SCOPe 2.05
  
• d3vgja_ appears in SCOPe 2.07
  
• d3vgja_ appears in the current release, SCOPe 2.08