Lineage for d3vgja_ (3vgj A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2106026Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2106027Protein automated matches [190459] (50 species)
    not a true protein
  7. 2106167Species Plasmodium falciparum [TaxId:36329] [269943] (7 PDB entries)
  8. 2106168Domain d3vgja_: 3vgj A: [269945]
    automated match to d2cyaa_
    protein/RNA complex; complexed with amp, tyr

Details for d3vgja_

PDB Entry: 3vgj (more details), 2.21 Å

PDB Description: crystal of plasmodium falciparum tyrosyl-trna synthetase (pftyrrs)in complex with adenylate analog
PDB Compounds: (A:) Tyrosyl-tRNA synthetase, putative

SCOPe Domain Sequences for d3vgja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vgja_ c.26.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
eeskiedvdkilndilsisseciqpdelrvklllkrklicydgfepsgrmhiaqgllksi
ivnkltsngctfifwiadwfahlnnkmsgdlkkikkvgsyfievwkscgmnmenvqflwa
seeinkkpneywslvldisrsfninrmkrclkimgrsegeenycsqilypcmqcadiffl
nvdicqlgidqrkvnmlareycdikkikkkpvilshgmlpgllegqekmsksdensaifm
ddsesdvnrkikkaycppnviennpiyayaksiifpsynefnlvrkeknggdktyytlqe
lehdyvngfihpldlkdnvamyinkllqpvrdhfqnnieaknllneikkykvt

SCOPe Domain Coordinates for d3vgja_:

Click to download the PDB-style file with coordinates for d3vgja_.
(The format of our PDB-style files is described here.)

Timeline for d3vgja_: