SCOPe 2.07: Domain d3vgjb_: 3vgj B:

Lineage for d3vgjb_ (3vgj B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (59 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [269943] (7 PDB entries)

8. Domain d3vgjb_: 3vgj B: [269944]
   automated match to d2cyaa_
   protein/RNA complex; complexed with amp, tyr

Details for d3vgjb_

PDB Entry: 3vgj, 2.21 Å

PDB Description: crystal of plasmodium falciparum tyrosyl-trna synthetase (pftyrrs)in complex with adenylate analog

PDB Compounds: (B:) Tyrosyl-tRNA synthetase, putative

SCOPe Domain Sequences for d3vgjb_:

Sequence; same for both SEQRES and ATOM records:

>d3vgjb_ c.26.1.0 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
aqeeskiedvdkilndilsisseciqpdelrvklllkrklicydgfepsgrmhiaqgllk
siivnkltsngctfifwiadwfahlnnkmsgdlkkikkvgsyfievwkscgmnmenvqfl
waseeinkkpneywslvldisrsfninrmkrclkimgrsegeenycsqilypcmqcadif
flnvdicqlgidqrkvnmlareycdikkikkkpvilshgmlpgllegqekmsksdensai
fmddsesdvnrkikkaycppnviennpiyayaksiifpsynefnlvrkeknggdktyytl
qelehdyvngfihpldlkdnvamyinkllqpvrdhfqnnieaknllneikkykvtk

Timeline for d3vgjb_:

• d3vgjb_ first appeared in SCOPe 2.05
  
• d3vgjb_ appears in SCOPe 2.06
  
• d3vgjb_ appears in the current release, SCOPe 2.08