Lineage for d4uuza_ (4uuz A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311419Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2311420Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2311421Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2311654Protein Histone H3 [47122] (6 species)
  7. 2311749Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [158386] (2 PDB entries)
  8. 2311752Domain d4uuza_: 4uuz A: [269942]
    Other proteins in same PDB: d4uuzb_
    automated match to d1tzyc_
    protein/DNA complex

Details for d4uuza_

PDB Entry: 4uuz (more details), 2.9 Å

PDB Description: mcm2-histone complex
PDB Compounds: (A:) histone h3

SCOPe Domain Sequences for d4uuza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uuza_ a.22.1.1 (A:) Histone H3 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
stellirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvglfedtnlcaihakr
vtimpkdiqlarrirgera

SCOPe Domain Coordinates for d4uuza_:

Click to download the PDB-style file with coordinates for d4uuza_.
(The format of our PDB-style files is described here.)

Timeline for d4uuza_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4uuzb_