Class a: All alpha proteins [46456] (289 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H3 [47122] (6 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [158386] (2 PDB entries) |
Domain d4uuza_: 4uuz A: [269942] Other proteins in same PDB: d4uuzb_ automated match to d1tzyc_ protein/DNA complex |
PDB Entry: 4uuz (more details), 2.9 Å
SCOPe Domain Sequences for d4uuza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uuza_ a.22.1.1 (A:) Histone H3 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} stellirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvglfedtnlcaihakr vtimpkdiqlarrirgera
Timeline for d4uuza_: