Lineage for d4uuzb_ (4uuz B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698677Protein automated matches [193445] (8 species)
    not a true protein
  7. 2698739Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225310] (3 PDB entries)
  8. 2698748Domain d4uuzb_: 4uuz B: [269940]
    Other proteins in same PDB: d4uuza_
    automated match to d1s32f_
    protein/DNA complex

Details for d4uuzb_

PDB Entry: 4uuz (more details), 2.9 Å

PDB Description: mcm2-histone complex
PDB Compounds: (B:) histone h4

SCOPe Domain Sequences for d4uuzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uuzb_ a.22.1.1 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvt
amdvvyalkrqgrtlygfg

SCOPe Domain Coordinates for d4uuzb_:

Click to download the PDB-style file with coordinates for d4uuzb_.
(The format of our PDB-style files is described here.)

Timeline for d4uuzb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4uuza_