Class a: All alpha proteins [46456] (290 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein automated matches [193445] (8 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225310] (3 PDB entries) |
Domain d4uuzb_: 4uuz B: [269940] Other proteins in same PDB: d4uuza_ automated match to d1s32f_ protein/DNA complex |
PDB Entry: 4uuz (more details), 2.9 Å
SCOPe Domain Sequences for d4uuzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uuzb_ a.22.1.1 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} rdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvt amdvvyalkrqgrtlygfg
Timeline for d4uuzb_: