![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins) Pfam PF00640 |
![]() | Protein Numb [50762] (2 species) |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [50763] (2 PDB entries) |
![]() | Domain d2nmba_: 2nmb A: [26994] complexed with a phosphotyrosine peptide |
PDB Entry: 2nmb (more details)
SCOPe Domain Sequences for d2nmba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nmba_ b.55.1.2 (A:) Numb {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} skphqwqadeeavrsatcsfsvkylgcvevfesrgmqvceealkvlrqsrrrpvrgllhv sgdglrvvddetkglivdqtiekvsfcapdrnhergfsyicrdgttrrwmchgflackds gerlshavgcafavclerkqrrtraaa
Timeline for d2nmba_: