SCOPe 2.05: Domain d4utoa_: 4uto A:

Lineage for d4utoa_ (4uto A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.92: Chelatase-like [53799] (3 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families)
   contains a long alpha helical insertion in the interdomain linker

5. Family c.92.2.2: TroA-like [53811] (6 proteins)

6. Protein automated matches [191053] (3 species)
   not a true protein

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [189842] (7 PDB entries)

8. Domain d4utoa_: 4uto A: [269937]
   automated match to d1psza_
   complexed with cd, trs

Details for d4utoa_

PDB Entry: 4uto, 1.55 Å

PDB Description: crystal structure of pneumococcal surface antigen psaa d280n in the cd-bound, open state

PDB Compounds: (A:) manganese abc transporter substrate-binding lipoprotein

SCOPe Domain Sequences for d4utoa_:

Sequence; same for both SEQRES and ATOM records:

>d4utoa_ c.92.2.2 (A:) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
klkvvatnsiiaditkniagdkidlhsivpigqdpheyeplpedvkktseadlifyngin
letggnawftklvenakktenkdyfavsdgvdviylegqnekgkedphawlnlengiifa
kniakqlsakdpnnkefyeknlkeytdkldkldkeskdkfnkipaekklivtsegafkyf
skaygvpsayiweinteeegtpeqiktlveklrqtkvpslfvessvddrpmktvsqdtni
piyaqiftnsiaeqgkegdsyysmmkynldkiaeglak

Timeline for d4utoa_:

• d4utoa_ is new in SCOPe 2.05-stable
  
• d4utoa_ appears in SCOPe 2.06
  
• d4utoa_ appears in the current release, SCOPe 2.08