Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein automated matches [190047] (37 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries) |
Domain d4urzr1: 4urz R:1-166 [269931] Other proteins in same PDB: d4urzr2, d4urzs_ automated match to d3gftc_ complexed with vjp |
PDB Entry: 4urz (more details), 2.24 Å
SCOPe Domain Sequences for d4urzr1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4urzr1 c.37.1.8 (R:1-166) automated matches {Human (Homo sapiens) [TaxId: 9606]} mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
Timeline for d4urzr1: