Lineage for d4us1s_ (4us1 S:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006307Fold a.117: Ras GEF [48365] (1 superfamily)
    multihelical
  4. 2006308Superfamily a.117.1: Ras GEF [48366] (1 family) (S)
  5. 2006309Family a.117.1.1: Ras GEF [48367] (2 protein domains)
  6. 2006325Protein automated matches [269917] (1 species)
    not a true protein
  7. 2006326Species Human (Homo sapiens) [TaxId:9606] [269918] (9 PDB entries)
  8. 2006333Domain d4us1s_: 4us1 S: [269930]
    Other proteins in same PDB: d4us1r1, d4us1r2
    automated match to d1nvus_
    complexed with l71

Details for d4us1s_

PDB Entry: 4us1 (more details), 2.65 Å

PDB Description: the crystal structure of h-ras and sos in complex with ligands
PDB Compounds: (S:) Son of sevenless homolog 1

SCOPe Domain Sequences for d4us1s_:

Sequence, based on SEQRES records: (download)

>d4us1s_ a.117.1.1 (S:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eqmrlpsadvyrfaepdseeniifeenmqpkagipiikagtviklierltyhmyadpnfv
rtflttyrsfckpqellsliierfeipepepteadriaiengdqplsaelkrfrkeyiqp
vqlrvlnvcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkiar
dngpghnitfqsspptvewhisrpghietfdlltlhpieiarqltllesdlyravqpsel
vgsvwtkedkeinspnllkmirhttnltlwfekcivetenleervavvsriieilqvfqe
lnnfngvlevvsamnsspvyrldhtfeqipsrqkkileeahelsedhykkylaklrsinp
pcvpffgiyltnilkteegnpevlkrhgkelinfskrrkvaeitgeiqqyqnqpyclrve
sdikrffenlnpmgnsmekeftdylfnksleieprnpkplprfpkkysyplkspgvrpsn
p

Sequence, based on observed residues (ATOM records): (download)

>d4us1s_ a.117.1.1 (S:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eqmrlpsadvyrfaepdseeniifeenmqpkagipiikagtviklierltyhmyadpnfv
rtflttyrsfckpqellsliierfeipepelsaelkrfrkeyiqpvqlrvlnvcrhwveh
hfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkiafqsspptvewhisrpg
hietfdlltlhpieiarqltllesdlyravqpselvgsvwtkedkeinspnllkmirhtt
nltlwfekcivetenleervavvsriieilqvfqelnnfngvlevvsamnsspvyrldht
feqipsrqkkileeahelsedhykkylaklrsinppcvpffgiyltnilkteegnpevlk
rhgkelinfskrrkvaeitgeiqqyqnqpyclrvesdikrffenlnpmgnsmekeftdyl
fnksleieprnpkplprfpkkysyplkspgvrpsnp

SCOPe Domain Coordinates for d4us1s_:

Click to download the PDB-style file with coordinates for d4us1s_.
(The format of our PDB-style files is described here.)

Timeline for d4us1s_: