Class b: All beta proteins [48724] (180 folds) |
Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins) Pfam PF00640 |
Protein Numb [50762] (3 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [50763] (2 PDB entries) |
Domain d1ddma_: 1ddm A: [26993] complexed to a nak peptide has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1ddm (more details)
SCOPe Domain Sequences for d1ddma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ddma_ b.55.1.2 (A:) Numb {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} hqwqadeeavrsatcsfsvkylgcvevfesrgmqvceealkvlrqsrrrpvrgllhvsgd glrvvddetkglivdqtiekvsfcapdrnhergfsyicrdgttrrwmchgflackdsger lshavgcafavcler
Timeline for d1ddma_: