Lineage for d1ddma_ (1ddm A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803365Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
    Pfam PF00640
  6. 2803407Protein Numb [50762] (3 species)
  7. 2803408Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [50763] (2 PDB entries)
  8. 2803409Domain d1ddma_: 1ddm A: [26993]
    complexed to a nak peptide
    has additional insertions and/or extensions that are not grouped together

Details for d1ddma_

PDB Entry: 1ddm (more details)

PDB Description: solution structure of the numb ptb domain complexed to a nak peptide
PDB Compounds: (A:) numb protein

SCOPe Domain Sequences for d1ddma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ddma_ b.55.1.2 (A:) Numb {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
hqwqadeeavrsatcsfsvkylgcvevfesrgmqvceealkvlrqsrrrpvrgllhvsgd
glrvvddetkglivdqtiekvsfcapdrnhergfsyicrdgttrrwmchgflackdsger
lshavgcafavcler

SCOPe Domain Coordinates for d1ddma_:

Click to download the PDB-style file with coordinates for d1ddma_.
(The format of our PDB-style files is described here.)

Timeline for d1ddma_: