SCOPe 2.05: Domain d4uoec_: 4uoe C:

Lineage for d4uoec_ (4uoe C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (49 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [187826] (15 PDB entries)

8. Domain d4uoec_: 4uoe C: [269920]
   automated match to d2i7ca_
   complexed with 1pg, 4zy, gol, mta

Details for d4uoec_

PDB Entry: 4uoe, 2.05 Å

PDB Description: crystal structure of plasmodium falciparum spermidine synthase in complex with 5'-deoxy-5'-methylioadenosine and 4-aminomethylaniline

PDB Compounds: (C:) spermidine synthase

SCOPe Domain Sequences for d4uoec_:

Sequence; same for both SEQRES and ATOM records:

>d4uoec_ c.66.1.0 (C:) automated matches {Plasmodium falciparum [TaxId: 36329]}
kkwfsefsimwpgqafslkikkilyetkskyqnvlvfesttygkvlvldgviqltekdef
ayhemmthvpmtvskepknvlvvgggdggiirelckyksvenidiceidetvievskiyf
kniscgyedkrvnvfiedaskflenvtntydviivdssdpigpaetlfnqnfyekiynal
kpngycvaqceslwihvgtiknmigyakklfkkveyanisiptypcgcigilccsktdtg
ltkpnkkleskefadlkyynyenhsaafklpafllkeieni

Timeline for d4uoec_:

• d4uoec_ is new in SCOPe 2.05-stable
  
• d4uoec_ appears in SCOPe 2.06
  
• d4uoec_ appears in the current release, SCOPe 2.08