Lineage for d1shca_ (1shc A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 805150Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 805151Superfamily b.55.1: PH domain-like [50729] (13 families) (S)
  5. 805395Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (12 proteins)
    Pfam PF00640
  6. 805444Protein Shc adaptor protein [50760] (1 species)
  7. 805445Species Human (Homo sapiens) [TaxId:9606] [50761] (3 PDB entries)
  8. 805448Domain d1shca_: 1shc A: [26992]

Details for d1shca_

PDB Entry: 1shc (more details)

PDB Description: shc ptb domain complexed with a trka receptor phosphopeptide, nmr, minimized average structure
PDB Compounds: (A:) shc

SCOP Domain Sequences for d1shca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1shca_ b.55.1.2 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]}
gshmgqlggeewtrhgsfvnkptrgwlhpndkvmgpgvsylvrymgcvevlqsmraldfn
trtqvtreaislvceavpgakgatrrrkpcsrplssilgrsnlkfagmpitltvstssln
lmaadckqiianhhmqsisfasggdpdtaeyvayvakdpvnqrachilecpeglaqdvis
tigqafelrfkqylr

SCOP Domain Coordinates for d1shca_:

Click to download the PDB-style file with coordinates for d1shca_.
(The format of our PDB-style files is described here.)

Timeline for d1shca_: