Lineage for d1shca_ (1shc A:)
- Root: SCOP 1.69
Class b: All beta proteins [48724] (144 folds) 
Fold b.55: PH domain-like [50728] (1 superfamily)
barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helixSuperfamily b.55.1: PH domain-like [50729] (9 families) 
Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (8 proteins) 
Protein Shc adaptor protein [50760] (1 species) Species Human (Homo sapiens) [TaxId:9606] [50761] (3 PDB entries) 
Domain d1shca_: 1shc A: [26992]
Details for d1shca_
PDB Entry: 1shc (more details)
PDB Description: shc ptb domain complexed with a trka receptor phosphopeptide, nmr, minimized average structure
SCOP Domain Sequences for d1shca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1shca_ b.55.1.2 (A:) Shc adaptor protein {Human (Homo sapiens)}
gshmgqlggeewtrhgsfvnkptrgwlhpndkvmgpgvsylvrymgcvevlqsmraldfn
trtqvtreaislvceavpgakgatrrrkpcsrplssilgrsnlkfagmpitltvstssln
lmaadckqiianhhmqsisfasggdpdtaeyvayvakdpvnqrachilecpeglaqdvis
tigqafelrfkqylr
SCOP Domain Coordinates for d1shca_:
Click to download the PDB-style file with coordinates for d1shca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1shca_:
- d1shca_ first appeared (with stable ids) in SCOP 1.55
- d1shca_ appears in SCOP 1.67
- d1shca_ appears in SCOP 1.71
- d1shca_ appears in the current release, SCOPe 2.08
View in 3D