![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (22 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188740] (276 PDB entries) |
![]() | Domain d4u3xa_: 4u3x A: [269911] Other proteins in same PDB: d4u3xb_, d4u3xd_ automated match to d1ohqa_ complexed with edo |
PDB Entry: 4u3x (more details), 2.26 Å
SCOPe Domain Sequences for d4u3xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4u3xa_ b.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vqllesggglvqpggslrlscaasgfrfdaedmgwvrqapgkglewvssiygpsgstyya dsvkgrftisrdnskntlylqmnslraedtavyycakytsppqnhgfdywgqgtlvtvs
Timeline for d4u3xa_: