SCOP 1.67: Domain d1irsa_: 1irs A:

Lineage for d1irsa_ (1irs A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.55: PH domain-like [50728] (1 superfamily)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (8 families)

5. Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (8 proteins)

6. Protein Insulin receptor substrate 1, IRS-1 [50758] (1 species)
   duplication: contains two domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [50759] (2 PDB entries)

8. Domain d1irsa_: 1irs A: [26991]
   second domain complexed with a IL-4 receptor phosphopeptide

Details for d1irsa_

PDB Entry: 1irs

PDB Description: irs-1 ptb domain complexed with a il-4 receptor phosphopeptide, nmr, minimized average structure

SCOP Domain Sequences for d1irsa_:

Sequence; same for both SEQRES and ATOM records:

>d1irsa_ b.55.1.2 (A:) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens)}
mgpafkevwqvilkpkglgqtknligiyrlcltsktisfvklnseaaavvlqlmnirrcg
hsenfffievgrsavtgpgefwmqvddsvvaqnmhetileamramsdefrpr

Timeline for d1irsa_:

• d1irsa_ first appeared (with stable ids) in SCOP 1.55
  
• d1irsa_ appears in SCOP 1.65
  
• d1irsa_ appears in SCOP 1.69
  
• d1irsa_ appears in the current release, SCOPe 2.08, called d1irsa1