Lineage for d4u5ib_ (4u5i B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (90 species)
    not a true protein
  7. 2083820Species Clostridium thermocellum [TaxId:203119] [269902] (4 PDB entries)
  8. 2083824Domain d4u5ib_: 4u5i B: [269906]
    automated match to d3azra_
    complexed with bxp; mutant

Details for d4u5ib_

PDB Entry: 4u5i (more details), 2.5 Å

PDB Description: complex structure of mutant ctcel5e (e314a) with xylobiose
PDB Compounds: (B:) endoglucanase h

SCOPe Domain Sequences for d4u5ib_:

Sequence, based on SEQRES records: (download)

>d4u5ib_ c.1.8.0 (B:) automated matches {Clostridium thermocellum [TaxId: 203119]}
kavdpfemvrkmgmgtnlgntleapyegswsksameyyfddfkaagyknvripvrwdnht
mrtypytidkafldrveqvvdwslsrgfvtiinshhddwikedyngnierfekiweqiae
rfknksenllfeimnepfgnitdeqiddmnsrilkiirktnptriviigggywnsyntlv
nikipddpyligtfhyydpyefthkwrgtwgtqedmdtvvrvfdfvkswsdrnnipvyfg
afavmayadrtsrvkwydfisdaalergfacsvwdngvfgsldndmaiynrdtrtfdtei
lnalf

Sequence, based on observed residues (ATOM records): (download)

>d4u5ib_ c.1.8.0 (B:) automated matches {Clostridium thermocellum [TaxId: 203119]}
kavdpfemvrkmgmgtnlgntleapyegswsksameyyfddfkaagyknvripvrwdnht
mrtypytidkafldrveqvvdwslsrgfvtiinshhddwikedyngnierfekiweqiae
rfknksenllfeimnepfgnitdeqiddmnsrilkiirktnptriviigggywnsyntlv
nikipddpyligtfhyydpyefthtwgtqedmdtvvrvfdfvkswsdrnnipvyfgafav
mayadrtsrvkwydfisdaalergfacsvwdngvfdmaiynrdtrtfdteilnalf

SCOPe Domain Coordinates for d4u5ib_:

Click to download the PDB-style file with coordinates for d4u5ib_.
(The format of our PDB-style files is described here.)

Timeline for d4u5ib_: